PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00002565-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB
Protein Properties Length: 354aa    MW: 39585 Da    PI: 7.0292
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00002565-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.61.6e-193380148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd++lv++++++G g+W++ ++  g++R++k+c++rw +yl
  WALNUT_00002565-RA 33 KGPWTPEEDQQLVKYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 80
                        79********************************************97 PP

2Myb_DNA-binding54.23.3e-1786131148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg++++eE++ ++++++ lG++ W++Ia++++ gRt++++k++w+++l
  WALNUT_00002565-RA  86 RGKFSEEEEQTILNLHAVLGNK-WSAIASRLP-GRTDNEIKNFWNTHL 131
                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-262583IPR009057Homeodomain-like
PROSITE profilePS5129418.9592880IPR017930Myb domain
SuperFamilySSF466895.24E-3230127IPR009057Homeodomain-like
SMARTSM007172.6E-163282IPR001005SANT/Myb domain
PfamPF002492.7E-183380IPR001005SANT/Myb domain
CDDcd001671.71E-123580No hitNo description
PROSITE profilePS5129426.60281135IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2784136IPR009057Homeodomain-like
SMARTSM007171.0E-1685133IPR001005SANT/Myb domain
PfamPF002492.5E-1686131IPR001005SANT/Myb domain
CDDcd001674.69E-1288131No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MYIYIWVGQQ ILKRKKEPKM GRPPSCDENG LKKGPWTPEE DQQLVKYIQK HGHGSWRALP  60
KLAGLNRCGK SCRLRWTNYL RPDIKRGKFS EEEEQTILNL HAVLGNKWSA IASRLPGRTD  120
NEIKNFWNTH LKKKLIHMGF DPMTHRPRTD ILSSLPHLIA LANLKELIDH HSWEEQALRL  180
QSAEAVQMAR LQYLQCLLQP LPSNGSTTAN SINSFTEMEI INHIKDNLGL GASHLDTPTP  240
SLGTSTGLQP GHDAIPFSHL PDLQIPCNDY QTPLNKENSV QAPEFTALIQ GESSLNSPWL  300
ASSSSTPSPS VVPPMTETSL NNLGDACSTS SYGEAAPSIW PDLLLEDLLF HEIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-30311355108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002307080.21e-157hypothetical protein POPTR_0005s07590g
SwissprotQ8GWP06e-70MYB39_ARATH; Transcription factor MYB39
TrEMBLB9H4T11e-157B9H4T1_POPTR; Uncharacterized protein
STRINGPOPTR_0005s07590.11e-156(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.12e-94myb domain protein 93